![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains) silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain |
![]() | Protein Sirt2 histone deacetylase [63987] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63988] (15 PDB entries) |
![]() | Domain d5mara1: 5mar A:56-355 [331104] Other proteins in same PDB: d5mara2, d5marb2 automated match to d4rmha_ complexed with 7ke, act, ar6, dms, edo, gol, zn |
PDB Entry: 5mar (more details), 1.89 Å
SCOPe Domain Sequences for d5mara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mara1 c.31.1.5 (A:56-355) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq
Timeline for d5mara1: