SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mara1 (5mar A:56-355)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107583Protein automated matches [191258] (2 species)
    not a true protein
  7. 2107587Species Human (Homo sapiens) [TaxId:9606] [189817] (16 PDB entries)
  8. 2287803Domain d5mara1: 5mar A:56-355 [331104]
    Other proteins in same PDB: d5mara2, d5marb2
    automated match to d4rmha_
    complexed with 7ke, act, ar6, dms, edo, gol, zn

Details for d5mara1

PDB Entry: 5mar (more details), 1.89 Å

PDB Description: structure of human sirt2 in complex with 1,2,4-oxadiazole inhibitor and adp ribose.
PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d5mara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mara1 c.31.1.5 (A:56-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp
flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

SCOPe Domain Coordinates for d5mara1:

Click to download the PDB-style file with coordinates for d5mara1.
(The format of our PDB-style files is described here.)

Timeline for d5mara1:

  • d5mara1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

2287803
d5mara1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5mara2