SCOPe 2.06: Domain d5mara1: 5mar A:56-355

Lineage for d5mara1 (5mar A:56-355)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
   silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain

6. Protein automated matches [191258] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189817] (16 PDB entries)

8. Domain d5mara1: 5mar A:56-355 [331104]
   Other proteins in same PDB: d5mara2, d5marb2
   automated match to d4rmha_
   complexed with 7ke, act, ar6, dms, edo, gol, zn

Details for d5mara1

PDB Entry: 5mar, 1.89 Å

PDB Description: structure of human sirt2 in complex with 1,2,4-oxadiazole inhibitor and adp ribose.

PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d5mara1:

Sequence; same for both SEQRES and ATOM records:

>d5mara1 c.31.1.5 (A:56-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp
flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

Timeline for d5mara1:

• d5mara1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16