Lineage for d5mtsa_ (5mts A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2033937Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2033958Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2034045Species Escherichia coli [TaxId:83333] [273015] (7 PDB entries)
  8. 2287800Domain d5mtsa_: 5mts A: [331101]
    automated match to d3zl2a_
    complexed with ni, xka

Details for d5mtsa_

PDB Entry: 5mts (more details), 2.6 Å

PDB Description: complex of fimh lectin with a tazman (thiazolylaminomannosides) family member known as potent anti-adhesive agent at 2.6 a resolution
PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d5mtsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mtsa_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5mtsa_:

Click to download the PDB-style file with coordinates for d5mtsa_.
(The format of our PDB-style files is described here.)

Timeline for d5mtsa_:

  • d5mtsa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16