SCOPe 2.06: Domain d5ihzf2: 5ihz F:128-229

Lineage for d5ihzf2 (5ihz F:128-229)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d5ihzf2: 5ihz F:128-229 [331091]
Other proteins in same PDB: d5ihzb1, d5ihzd1, d5ihzf1, d5ihzl1
automated match to d5azel2

Details for d5ihzf2

PDB Entry: 5ihz (more details), 1.64 Å

PDB Description: crystal structure of anti-gliadin 1002-1e01 fab fragment

PDB Compounds: (F:) 1E01 Fab fragment light chain

SCOPe Domain Sequences for d5ihzf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihzf2 b.1.1.2 (F:128-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d5ihzf2:

Click to download the PDB-style file with coordinates for d5ihzf2.
(The format of our PDB-style files is described here.)

Timeline for d5ihzf2: