Lineage for d5marb1 (5mar B:56-355)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444630Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2444631Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2444911Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2444971Protein Sirt2 histone deacetylase [63987] (1 species)
  7. 2444972Species Human (Homo sapiens) [TaxId:9606] [63988] (15 PDB entries)
  8. 2444987Domain d5marb1: 5mar B:56-355 [331084]
    Other proteins in same PDB: d5mara2, d5marb2
    automated match to d4rmha_
    complexed with 7ke, act, ar6, dms, edo, gol, zn

Details for d5marb1

PDB Entry: 5mar (more details), 1.89 Å

PDB Description: structure of human sirt2 in complex with 1,2,4-oxadiazole inhibitor and adp ribose.
PDB Compounds: (B:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d5marb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5marb1 c.31.1.5 (B:56-355) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp
flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

SCOPe Domain Coordinates for d5marb1:

Click to download the PDB-style file with coordinates for d5marb1.
(The format of our PDB-style files is described here.)

Timeline for d5marb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5marb2