SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mtsb_ (5mts B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2033937Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2033958Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2034045Species Escherichia coli [TaxId:83333] [273015] (7 PDB entries)
  8. 2287782Domain d5mtsb_: 5mts B: [331083]
    automated match to d3zl2a_
    complexed with ni, xka

Details for d5mtsb_

PDB Entry: 5mts (more details), 2.6 Å

PDB Description: complex of fimh lectin with a tazman (thiazolylaminomannosides) family member known as potent anti-adhesive agent at 2.6 a resolution
PDB Compounds: (B:) protein fimh

SCOPe Domain Sequences for d5mtsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mtsb_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5mtsb_:

Click to download the PDB-style file with coordinates for d5mtsb_.
(The format of our PDB-style files is described here.)

Timeline for d5mtsb_:

  • d5mtsb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16