Lineage for d1pkm_3 (1pkm 396-530)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) 
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) Protein Pyruvate kinase, C-terminal domain [52937] (5 species) 
Species Cat (Felis domestica) [TaxId:9685] [52938] (1 PDB entry) 
Domain d1pkm_3: 1pkm 396-530 [33108]
Other proteins in same PDB: d1pkm_1, d1pkm_2
Details for d1pkm_3
PDB Entry: 1pkm (more details), 2.6 Å
PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms
SCOP Domain Sequences for d1pkm_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkm_3 c.49.1.1 (396-530) Pyruvate kinase, C-terminal domain {Cat (Felis domestica)}
elvrgsshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkhgdvvivltgwr
pgsgftntmrvvpvp
SCOP Domain Coordinates for d1pkm_3:
Click to download the PDB-style file with coordinates for d1pkm_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pkm_3:
- d1pkm_3 appears in SCOP 1.57
- d1pkm_3 appears in the current release, SCOPe 2.08, called d1pkma3
View in 3D
