Lineage for d5hzta_ (5hzt A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165406Species Echinophyllia sp. [TaxId:301887] [188534] (16 PDB entries)
  8. 2287776Domain d5hzta_: 5hzt A: [331077]
    automated match to d2gx2a_
    complexed with cu

Details for d5hzta_

PDB Entry: 5hzt (more details), 2.84 Å

PDB Description: crystal structure of dronpa-cu2+
PDB Compounds: (A:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d5hzta_:

Sequence, based on SEQRES records: (download)

>d5hzta_ d.22.1.0 (A:) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
vqlpdyhfvdhhieikshdkdysnvnlhehaeahse

Sequence, based on observed residues (ATOM records): (download)

>d5hzta_ d.22.1.0 (A:) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
ygnrvfakyegyswersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkr
tvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakhfvdhhieikshdkd
ysnvnlhehaeahse

SCOPe Domain Coordinates for d5hzta_:

Click to download the PDB-style file with coordinates for d5hzta_.
(The format of our PDB-style files is described here.)

Timeline for d5hzta_:

  • d5hzta_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16