Lineage for d5jhaa3 (5jha A:726-1088)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195572Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 2195573Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2195574Species Human (Homo sapiens) [TaxId:9606] [56174] (64 PDB entries)
  8. 2287775Domain d5jhaa3: 5jha A:726-1088 [331076]
    Other proteins in same PDB: d5jhaa1, d5jhaa2
    automated match to d1he8a4
    complexed with 6k7, so4

Details for d5jhaa3

PDB Entry: 5jha (more details), 2.51 Å

PDB Description: structure of phosphoinositide 3-kinase gamma (pi3k) bound to the potent inhibitor pikin2
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5jhaa3:

Sequence, based on SEQRES records: (download)

>d5jhaa3 d.144.1.4 (A:726-1088) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wfl

Sequence, based on observed residues (ATOM records): (download)

>d5jhaa3 d.144.1.4 (A:726-1088) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnpesfrvpyd
pglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqil
rimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvfkdevlnhwlke
kspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghirvpfv
ltpdflfvmgttsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmptskedieyir
daltvgkneedakkyfldqievcrdkgwtvqfnwfl

SCOPe Domain Coordinates for d5jhaa3:

Click to download the PDB-style file with coordinates for d5jhaa3.
(The format of our PDB-style files is described here.)

Timeline for d5jhaa3:

  • d5jhaa3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16