SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jhaa3 (5jha A:726-1088)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195572Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 2195573Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2195574Species Human (Homo sapiens) [TaxId:9606] [56174] (61 PDB entries)
  8. 2287775Domain d5jhaa3: 5jha A:726-1088 [331076]
    Other proteins in same PDB: d5jhaa1, d5jhaa2
    automated match to d1he8a4
    complexed with 6k7, so4

Details for d5jhaa3

PDB Entry: 5jha (more details), 2.51 Å

PDB Description: structure of phosphoinositide 3-kinase gamma (pi3k) bound to the potent inhibitor pikin2
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5jhaa3:

Sequence, based on SEQRES records: (download)

>d5jhaa3 d.144.1.4 (A:726-1088) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wfl

Sequence, based on observed residues (ATOM records): (download)

>d5jhaa3 d.144.1.4 (A:726-1088) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnpesfrvpyd
pglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqil
rimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvfkdevlnhwlke
kspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghirvpfv
ltpdflfvmgttsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmptskedieyir
daltvgkneedakkyfldqievcrdkgwtvqfnwfl

SCOPe Domain Coordinates for d5jhaa3:

Click to download the PDB-style file with coordinates for d5jhaa3.
(The format of our PDB-style files is described here.)

Timeline for d5jhaa3:

  • d5jhaa3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16