SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jhaa2 (5jha A:545-725)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006533Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
  6. 2006534Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2006535Species Human (Homo sapiens) [TaxId:9606] [48402] (61 PDB entries)
  8. 2287774Domain d5jhaa2: 5jha A:545-725 [331075]
    Other proteins in same PDB: d5jhaa1, d5jhaa3
    automated match to d1e8ya1
    complexed with 6k7, so4

Details for d5jhaa2

PDB Entry: 5jha (more details), 2.51 Å

PDB Description: structure of phosphoinositide 3-kinase gamma (pi3k) bound to the potent inhibitor pikin2
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5jhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhaa2 a.118.1.6 (A:545-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
g

SCOPe Domain Coordinates for d5jhaa2:

Click to download the PDB-style file with coordinates for d5jhaa2.
(The format of our PDB-style files is described here.)

Timeline for d5jhaa2:

  • d5jhaa2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16