Lineage for d5jhaa2 (5jha A:545-725)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006533Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
  6. 2006534Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2006535Species Human (Homo sapiens) [TaxId:9606] [48402] (64 PDB entries)
  8. 2287774Domain d5jhaa2: 5jha A:545-725 [331075]
    Other proteins in same PDB: d5jhaa1, d5jhaa3
    automated match to d1e8ya1
    complexed with 6k7, so4

Details for d5jhaa2

PDB Entry: 5jha (more details), 2.51 Å

PDB Description: structure of phosphoinositide 3-kinase gamma (pi3k) bound to the potent inhibitor pikin2
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5jhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhaa2 a.118.1.6 (A:545-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
g

SCOPe Domain Coordinates for d5jhaa2:

Click to download the PDB-style file with coordinates for d5jhaa2.
(The format of our PDB-style files is described here.)

Timeline for d5jhaa2:

  • d5jhaa2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16