SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jhaa1 (5jha A:145-321)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159292Family d.15.1.5: Ras-binding domain, RBD [54263] (14 protein domains)
    contains Pfam PF00788 and Pfam PF02196
  6. 2159312Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 2159313Species Human (Homo sapiens) [TaxId:9606] [54276] (61 PDB entries)
  8. 2287773Domain d5jhaa1: 5jha A:145-321 [331074]
    Other proteins in same PDB: d5jhaa2, d5jhaa3
    automated match to d1he8a3
    complexed with 6k7, so4

Details for d5jhaa1

PDB Entry: 5jha (more details), 2.51 Å

PDB Description: structure of phosphoinositide 3-kinase gamma (pi3k) bound to the potent inhibitor pikin2
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5jhaa1:

Sequence, based on SEQRES records: (download)

>d5jhaa1 d.15.1.5 (A:145-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
eesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvts
kplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipes
qseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d5jhaa1 d.15.1.5 (A:145-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
eesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvts
kplpeylwkkianncifivihsqtikvspddtpgailqsfftqdfvlrvcgrdeylvget
piknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d5jhaa1:

Click to download the PDB-style file with coordinates for d5jhaa1.
(The format of our PDB-style files is described here.)

Timeline for d5jhaa1:

  • d5jhaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16