Lineage for d2pdab3 (2pda B:259-415)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488664Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 2488665Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 2488666Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries)
  8. 2488686Domain d2pdab3: 2pda B:259-415 [33107]
    Other proteins in same PDB: d2pdaa1, d2pdaa2, d2pdaa4, d2pdaa5, d2pdab1, d2pdab2, d2pdab4, d2pdab5
    complexed with ca, mg, pyr, sf4, tpp

Details for d2pdab3

PDB Entry: 2pda (more details), 3 Å

PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.
PDB Compounds: (B:) protein (pyruvate-ferredoxin oxidoreductase)

SCOPe Domain Sequences for d2pdab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdab3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOPe Domain Coordinates for d2pdab3:

Click to download the PDB-style file with coordinates for d2pdab3.
(The format of our PDB-style files is described here.)

Timeline for d2pdab3: