Lineage for d5ij6a1 (5ij6 A:1-249)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (13 species)
    not a true protein
  7. 2532972Species Enterococcus faecalis [TaxId:226185] [330979] (5 PDB entries)
  8. 2532979Domain d5ij6a1: 5ij6 A:1-249 [331068]
    Other proteins in same PDB: d5ij6a2, d5ij6a3
    automated match to d1vqza2
    complexed with cl, lpa, so4

Details for d5ij6a1

PDB Entry: 5ij6 (more details), 2 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-1) in complex with lipoic acid
PDB Compounds: (A:) Lipoate--protein ligase

SCOPe Domain Sequences for d5ij6a1:

Sequence, based on SEQRES records: (download)

>d5ij6a1 d.104.1.0 (A:1-249) automated matches {Enterococcus faecalis [TaxId: 226185]}
mryvimqsrdirenlatedyllntlsfeeplvlfyiqepcvilgrnqnayeeidlayare
kgivitrrlsgggavyddlgnvsfsfvvqeghqafgdfkaftkpiiealhkmgatgaeis
grndllidgkkfsgnamytkkgkmythgtlmydvdlaevqrvltvskkkieskgtksvrg
rvtnlrpyldekyqqltieefrnrllmelfdveslteiaekeyvltkadqqeirklvaev
ygneawifg

Sequence, based on observed residues (ATOM records): (download)

>d5ij6a1 d.104.1.0 (A:1-249) automated matches {Enterococcus faecalis [TaxId: 226185]}
mryvimqsrdirenlatedyllntlsfeeplvlfyiqepcvilgrnqnayeeidlayare
kgivitrrlsgggavyddlgnvsfsfvvqeghqafgdfkaftkpiiealhkmgatgaeis
grndllidgkkfsgnamytkkgkmythgtlmydvdlaevqrvltrvtnlrpyldekyqql
tieefrnrllmelfdveslteiaekeyvltkadqqeirklvaevygneawifg

SCOPe Domain Coordinates for d5ij6a1:

Click to download the PDB-style file with coordinates for d5ij6a1.
(The format of our PDB-style files is described here.)

Timeline for d5ij6a1: