SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ij6a1 (5ij6 A:1-249)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2186951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2187333Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2187334Protein automated matches [226887] (11 species)
    not a true protein
  7. 2287678Species Enterococcus faecalis [TaxId:226185] [330979] (5 PDB entries)
  8. 2287767Domain d5ij6a1: 5ij6 A:1-249 [331068]
    Other proteins in same PDB: d5ij6a2, d5ij6a3
    automated match to d1vqza2
    complexed with cl, lpa, so4

Details for d5ij6a1

PDB Entry: 5ij6 (more details), 2 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-1) in complex with lipoic acid
PDB Compounds: (A:) Lipoate--protein ligase

SCOPe Domain Sequences for d5ij6a1:

Sequence, based on SEQRES records: (download)

>d5ij6a1 d.104.1.0 (A:1-249) automated matches {Enterococcus faecalis [TaxId: 226185]}
mryvimqsrdirenlatedyllntlsfeeplvlfyiqepcvilgrnqnayeeidlayare
kgivitrrlsgggavyddlgnvsfsfvvqeghqafgdfkaftkpiiealhkmgatgaeis
grndllidgkkfsgnamytkkgkmythgtlmydvdlaevqrvltvskkkieskgtksvrg
rvtnlrpyldekyqqltieefrnrllmelfdveslteiaekeyvltkadqqeirklvaev
ygneawifg

Sequence, based on observed residues (ATOM records): (download)

>d5ij6a1 d.104.1.0 (A:1-249) automated matches {Enterococcus faecalis [TaxId: 226185]}
mryvimqsrdirenlatedyllntlsfeeplvlfyiqepcvilgrnqnayeeidlayare
kgivitrrlsgggavyddlgnvsfsfvvqeghqafgdfkaftkpiiealhkmgatgaeis
grndllidgkkfsgnamytkkgkmythgtlmydvdlaevqrvltrvtnlrpyldekyqql
tieefrnrllmelfdveslteiaekeyvltkadqqeirklvaevygneawifg

SCOPe Domain Coordinates for d5ij6a1:

Click to download the PDB-style file with coordinates for d5ij6a1.
(The format of our PDB-style files is described here.)

Timeline for d5ij6a1:

  • d5ij6a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16