![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein) |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [52933] (3 PDB entries) |
![]() | Domain d2pdaa3: 2pda A:259-415 [33106] Other proteins in same PDB: d2pdaa1, d2pdaa2, d2pdaa4, d2pdaa5, d2pdab1, d2pdab2, d2pdab4, d2pdab5 |
PDB Entry: 2pda (more details), 3 Å
SCOP Domain Sequences for d2pdaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pdaa3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus} klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv ydnmsgakknhftvgieddvtgtslpvdnafadttpk
Timeline for d2pdaa3: