Lineage for d5hzse_ (5hzs E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2185154Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2185155Protein automated matches [190526] (21 species)
    not a true protein
  7. 2185266Species Echinophyllia sp. [TaxId:301887] [188534] (16 PDB entries)
  8. 2185355Domain d5hzse_: 5hzs E: [331056]
    automated match to d2gx2a_
    complexed with co

Details for d5hzse_

PDB Entry: 5hzs (more details), 2.17 Å

PDB Description: crystal structure of dronpa-co2+
PDB Compounds: (E:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d5hzse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hzse_ d.22.1.0 (E:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d5hzse_:

Click to download the PDB-style file with coordinates for d5hzse_.
(The format of our PDB-style files is described here.)

Timeline for d5hzse_: