SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5icla2 (5icl A:248-334)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213792Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2213793Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2213847Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 2213848Protein automated matches [190942] (5 species)
    not a true protein
  7. 2287680Species Enterococcus faecalis [TaxId:226185] [330981] (5 PDB entries)
  8. 2287753Domain d5icla2: 5icl A:248-334 [331054]
    Other proteins in same PDB: d5icla1, d5icla3, d5iclb1, d5iclb3
    automated match to d1vqza1
    complexed with laq

Details for d5icla2

PDB Entry: 5icl (more details), 1.8 Å

PDB Description: crystal structure of enterococcus faecalis lipoate-protein ligase a (lpla-2) in complex with lipoyl-amp
PDB Compounds: (A:) Lipoate--protein ligase

SCOPe Domain Sequences for d5icla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icla2 d.224.1.0 (A:248-334) automated matches {Enterococcus faecalis [TaxId: 226185]}
kspafnlerrhrfpigsiemkmnvadgaiqeikifgdffglgeikdvediltgvkydkas
leeaidqidvkkyfgniekedllgliy

SCOPe Domain Coordinates for d5icla2:

Click to download the PDB-style file with coordinates for d5icla2.
(The format of our PDB-style files is described here.)

Timeline for d5icla2:

  • d5icla2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16