SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ls3a_ (5ls3 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2206129Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2206130Protein automated matches [190418] (18 species)
    not a true protein
  7. 2206239Species Pseudomonas aeruginosa [TaxId:287] [187706] (16 PDB entries)
  8. 2287750Domain d5ls3a_: 5ls3 A: [331051]
    automated match to d4bp0a_
    complexed with zn; mutant

Details for d5ls3a_

PDB Entry: 5ls3 (more details), 1.75 Å

PDB Description: crystal structure of metallo-beta-lactamase spm-1 with y58c mutation
PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d5ls3a_:

Sequence, based on SEQRES records: (download)

>d5ls3a_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfcssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefyk
nedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllf
ggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekav
gemrl

Sequence, based on observed residues (ATOM records): (download)

>d5ls3a_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfcssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdfyknedlkr
rilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllfggcmik
pkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekavgemrl

SCOPe Domain Coordinates for d5ls3a_:

Click to download the PDB-style file with coordinates for d5ls3a_.
(The format of our PDB-style files is described here.)

Timeline for d5ls3a_:

  • d5ls3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16