Lineage for d5ls3a_ (5ls3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (18 species)
    not a true protein
  7. 2556112Species Pseudomonas aeruginosa [TaxId:287] [187706] (18 PDB entries)
  8. 2556132Domain d5ls3a_: 5ls3 A: [331051]
    automated match to d4bp0a_
    complexed with zn; mutant

Details for d5ls3a_

PDB Entry: 5ls3 (more details), 1.75 Å

PDB Description: crystal structure of metallo-beta-lactamase spm-1 with y58c mutation
PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d5ls3a_:

Sequence, based on SEQRES records: (download)

>d5ls3a_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfcssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefyk
nedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllf
ggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekav
gemrl

Sequence, based on observed residues (ATOM records): (download)

>d5ls3a_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfcssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdfyknedlkr
rilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllfggcmik
pkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekavgemrl

SCOPe Domain Coordinates for d5ls3a_:

Click to download the PDB-style file with coordinates for d5ls3a_.
(The format of our PDB-style files is described here.)

Timeline for d5ls3a_: