SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ksxf_ (5ksx F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010549Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 protein domains)
  6. 2010594Protein automated matches [190489] (5 species)
    not a true protein
  7. 2010595Species Human (Homo sapiens) [TaxId:9606] [187688] (78 PDB entries)
  8. 2287747Domain d5ksxf_: 5ksx F: [331048]
    automated match to d4demf_
    complexed with 7am, po4

Details for d5ksxf_

PDB Entry: 5ksx (more details), 2.65 Å

PDB Description: crystal structure of human fpps in complex with an allosteric inhibitor am-02-072
PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d5ksxf_:

Sequence, based on SEQRES records: (download)

>d5ksxf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvvaf
relveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvglda
indanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvrf
tekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldl
fgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeel
dlpavflqyeedsyshimalieqyaaplppavflglarkiykr

Sequence, based on observed residues (ATOM records): (download)

>d5ksxf_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyaqekqdfvqhfsqivrvlteghpeigdaiarlkevleynaiggkynrgltvvvafrel
veprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgldaind
anlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqnvdlvrftekr
yksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlfgdp
svtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeldlpa
vflqyeedsyshimalieqyaaplppavflglarkiykr

SCOPe Domain Coordinates for d5ksxf_:

Click to download the PDB-style file with coordinates for d5ksxf_.
(The format of our PDB-style files is described here.)

Timeline for d5ksxf_:

  • d5ksxf_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16