SCOPe 2.06: Domain d5k52d_: 5k52 D:

Lineage for d5k52d_ (5k52 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.6: PMT1231-like [158402] (2 proteins)
   PfamB PB016165
   automatically mapped to Pfam PF11266

6. Protein automated matches [261918] (4 species)
   not a true protein

7. Species Limnothrix sp. [TaxId:1162714] [331043] (1 PDB entry)

8. Domain d5k52d_: 5k52 D: [331044]
   automated match to d4z5sa_
   complexed with ocd

Details for d5k52d_

PDB Entry: 5k52, 2.4 Å

PDB Description: crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012

PDB Compounds: (D:) Aldehyde decarbonylase

SCOPe Domain Sequences for d5k52d_:

Sequence; same for both SEQRES and ATOM records:

>d5k52d_ a.25.1.6 (D:) automated matches {Limnothrix sp. [TaxId: 1162714]}
idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
vlgmekealmedftiayqealqnigfstretlrmltaglaa

Timeline for d5k52d_:

• d5k52d_ is new in SCOPe 2.06-stable
  
• d5k52d_ appears in SCOPe 2.07
  
• d5k52d_ appears in the current release, SCOPe 2.08, called d5k52d1