Lineage for d1b0pa3 (1b0p A:259-415)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245392Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 245393Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 245429Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 245430Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 245431Species Desulfovibrio africanus [TaxId:873] [52933] (3 PDB entries)
  8. 245434Domain d1b0pa3: 1b0p A:259-415 [33104]
    Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa4, d1b0pa5, d1b0pb1, d1b0pb2, d1b0pb4, d1b0pb5

Details for d1b0pa3

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus

SCOP Domain Sequences for d1b0pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pa3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOP Domain Coordinates for d1b0pa3:

Click to download the PDB-style file with coordinates for d1b0pa3.
(The format of our PDB-style files is described here.)

Timeline for d1b0pa3: