Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) |
Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein) |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [52933] (3 PDB entries) |
Domain d1b0pa3: 1b0p A:259-415 [33104] Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa4, d1b0pa5, d1b0pb1, d1b0pb2, d1b0pb4, d1b0pb5 |
PDB Entry: 1b0p (more details), 2.31 Å
SCOP Domain Sequences for d1b0pa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0pa3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus} klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv ydnmsgakknhftvgieddvtgtslpvdnafadttpk
Timeline for d1b0pa3: