SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ipfd_ (5ipf D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2287701Species Schistosoma mansoni [TaxId:6183] [331002] (1 PDB entry)
  8. 2287735Domain d5ipfd_: 5ipf D: [331036]
    automated match to d2vfab_
    complexed with imp

Details for d5ipfd_

PDB Entry: 5ipf (more details), 2.8 Å

PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from schistosoma mansoni in complex with imp
PDB Compounds: (D:) Hypoxanthine-guanine phosphoribosyltransferase (HGPRT)

SCOPe Domain Sequences for d5ipfd_:

Sequence, based on SEQRES records: (download)

>d5ipfd_ c.61.1.0 (D:) automated matches {Schistosoma mansoni [TaxId: 6183]}
adcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnats
itlmcvlkggfkfladlvdglertvrargivlpmsvefvrvksyvndvsihepiltglgd
pseykdknvlvvediidtgktitklishldslstksvkvasllvkrtsprndyrpdfvgf
evpnrfvvgyaldyndnfrdlhhicvinevgqkkfsv

Sequence, based on observed residues (ATOM records): (download)

>d5ipfd_ c.61.1.0 (D:) automated matches {Schistosoma mansoni [TaxId: 6183]}
adcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnats
itlmcvlkggfkfladlvdglertvrargivlpmsvefvrdknvlvvediidtgktitkl
ishldsstksvkvasllvkrtrndyrpdfvgfevpnrfvvgyaldyndnfrdlhhicvin
evgqkkfsv

SCOPe Domain Coordinates for d5ipfd_:

Click to download the PDB-style file with coordinates for d5ipfd_.
(The format of our PDB-style files is described here.)

Timeline for d5ipfd_:

  • d5ipfd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16