Class b: All beta proteins [48724] (177 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (18 PDB entries) |
Domain d5j6sa1: 5j6s A:53-271 [331031] Other proteins in same PDB: d5j6sa2, d5j6sa3, d5j6sa4, d5j6sa5, d5j6sb2, d5j6sb3, d5j6sb4, d5j6sb5 automated match to d3se6a1 complexed with 6ga, bma, man, nag, zn |
PDB Entry: 5j6s (more details), 2.8 Å
SCOPe Domain Sequences for d5j6sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j6sa1 b.98.1.0 (A:53-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhs kdleitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqakl gdgfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhia lsnmpkvktielegglledhfettvkmstylvayivcdf
Timeline for d5j6sa1: