Lineage for d5j6sa1 (5j6s A:53-271)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820691Domain d5j6sa1: 5j6s A:53-271 [331031]
    Other proteins in same PDB: d5j6sa2, d5j6sa3, d5j6sa4, d5j6sa5, d5j6sb2, d5j6sb3, d5j6sb4, d5j6sb5
    automated match to d3se6a1
    complexed with 6ga, nag, zn

Details for d5j6sa1

PDB Entry: 5j6s (more details), 2.8 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a hydroxamic derivative ligand
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5j6sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j6sa1 b.98.1.0 (A:53-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhs
kdleitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqakl
gdgfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhia
lsnmpkvktielegglledhfettvkmstylvayivcdf

SCOPe Domain Coordinates for d5j6sa1:

Click to download the PDB-style file with coordinates for d5j6sa1.
(The format of our PDB-style files is described here.)

Timeline for d5j6sa1: