Lineage for d5hnta_ (5hnt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081137Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2081138Species Human (Homo sapiens) [TaxId:9606] [102052] (43 PDB entries)
    Uniprot P42330
  8. 2287729Domain d5hnta_: 5hnt A: [331030]
    automated match to d3uwea_
    complexed with nap, qap

Details for d5hnta_

PDB Entry: 5hnt (more details), 2 Å

PDB Description: crystal structure of akr1c3 complexed with cape
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d5hnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hnta_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypys

SCOPe Domain Coordinates for d5hnta_:

Click to download the PDB-style file with coordinates for d5hnta_.
(The format of our PDB-style files is described here.)

Timeline for d5hnta_:

  • d5hnta_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16