SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j6sb3 (5j6s B:547-637)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033616Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2033638Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2033639Protein automated matches [254707] (4 species)
    not a true protein
  7. 2033640Species Human (Homo sapiens) [TaxId:9606] [255965] (15 PDB entries)
  8. 2287720Domain d5j6sb3: 5j6s B:547-637 [331021]
    Other proteins in same PDB: d5j6sa1, d5j6sa2, d5j6sa4, d5j6sa5, d5j6sb1, d5j6sb2, d5j6sb4, d5j6sb5
    automated match to d3se6a3
    complexed with 6ga, bma, man, nag, zn

Details for d5j6sb3

PDB Entry: 5j6s (more details), 2.8 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a hydroxamic derivative ligand
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5j6sb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j6sb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg

SCOPe Domain Coordinates for d5j6sb3:

Click to download the PDB-style file with coordinates for d5j6sb3.
(The format of our PDB-style files is described here.)

Timeline for d5j6sb3:

  • d5j6sb3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16