Lineage for d5j6sb2 (5j6s B:272-546)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2184728Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2184729Protein automated matches [190805] (17 species)
    not a true protein
  7. 2184748Species Human (Homo sapiens) [TaxId:9606] [188286] (42 PDB entries)
  8. 2287719Domain d5j6sb2: 5j6s B:272-546 [331020]
    Other proteins in same PDB: d5j6sa1, d5j6sa3, d5j6sa4, d5j6sa5, d5j6sb1, d5j6sb3, d5j6sb4, d5j6sb5
    automated match to d3se6a2
    complexed with 6ga, bma, man, nag, zn

Details for d5j6sb2

PDB Entry: 5j6s (more details), 2.8 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a hydroxamic derivative ligand
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5j6sb2:

Sequence, based on SEQRES records: (download)

>d5j6sb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg
gvchsdpkmtsnmlaflgenaevkemmttwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d5j6sb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsevkemmttw
tlqkg

SCOPe Domain Coordinates for d5j6sb2:

Click to download the PDB-style file with coordinates for d5j6sb2.
(The format of our PDB-style files is described here.)

Timeline for d5j6sb2:

  • d5j6sb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16