Lineage for d1dtwb2 (1dtw B:205-342)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71301Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)
  4. 71302Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) (S)
  5. 71318Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-domain [52926] (2 proteins)
  6. 71322Protein Branched-chain alpha-keto acid dehydrogenase [52927] (1 species)
  7. 71323Species Human (Homo sapiens) [TaxId:9606] [52928] (1 PDB entry)
  8. 71324Domain d1dtwb2: 1dtw B:205-342 [33102]
    Other proteins in same PDB: d1dtwa1, d1dtwb1

Details for d1dtwb2

PDB Entry: 1dtw (more details), 2.7 Å

PDB Description: human branched-chain alpha-keto acid dehydrogenase

SCOP Domain Sequences for d1dtwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtwb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOP Domain Coordinates for d1dtwb2:

Click to download the PDB-style file with coordinates for d1dtwb2.
(The format of our PDB-style files is described here.)

Timeline for d1dtwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dtwb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1dtwa1