Lineage for d5ipeb_ (5ipe B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157130Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2157196Protein automated matches [191082] (2 species)
    not a true protein
  7. 2157202Species Human (Homo sapiens) [TaxId:9606] [189791] (35 PDB entries)
  8. 2287716Domain d5ipeb_: 5ipe B: [331017]
    automated match to d3tw2a_
    complexed with 6cg, cl, edo

Details for d5ipeb_

PDB Entry: 5ipe (more details), 1.45 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint1) nucleoside thiophosphoramidate catalytic product complex
PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5ipeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ipeb_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesll
ghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d5ipeb_:

Click to download the PDB-style file with coordinates for d5ipeb_.
(The format of our PDB-style files is described here.)

Timeline for d5ipeb_:

  • d5ipeb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16