SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ipeb_ (5ipe B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157130Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2157196Protein automated matches [191082] (2 species)
    not a true protein
  7. 2157202Species Human (Homo sapiens) [TaxId:9606] [189791] (16 PDB entries)
  8. 2287716Domain d5ipeb_: 5ipe B: [331017]
    automated match to d3tw2a_
    complexed with 6cg, cl, edo

Details for d5ipeb_

PDB Entry: 5ipe (more details), 1.45 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint1) nucleoside thiophosphoramidate catalytic product complex
PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5ipeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ipeb_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesll
ghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d5ipeb_:

Click to download the PDB-style file with coordinates for d5ipeb_.
(The format of our PDB-style files is described here.)

Timeline for d5ipeb_:

  • d5ipeb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16