Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.36: Collagen-binding domain [267607] (1 protein) PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_) |
Protein Class 1 collagenase [267633] (1 species) |
Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries) |
Domain d5ikua2: 5iku A:891-1008 [331007] Other proteins in same PDB: d5ikua3 automated match to d1nqda_ complexed with ca |
PDB Entry: 5iku (more details), 1.9 Å
SCOPe Domain Sequences for d5ikua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ikua2 b.18.1.36 (A:891-1008) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]} glgneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkd efgvtwtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk
Timeline for d5ikua2: