SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ikua1 (5iku A:773-890)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039933Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
    PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)
  6. 2039934Protein Class 1 collagenase [267633] (1 species)
  7. 2039935Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries)
  8. 2287705Domain d5ikua1: 5iku A:773-890 [331006]
    Other proteins in same PDB: d5ikua3
    automated match to d1nqda_
    complexed with ca

Details for d5ikua1

PDB Entry: 5iku (more details), 1.9 Å

PDB Description: crystal structure of the clostridium histolyticum colg tandem collagen-binding domain s3as3b in the presence of calcium at 1.9 angstrom resolution
PDB Compounds: (A:) collagenase

SCOPe Domain Sequences for d5ikua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ikua1 b.18.1.36 (A:773-890) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
tttpitkemepnddikeangpivegvtvkgdlngsddadtfyfdvkedgdvtielpysgs
snftwlvykegddqnhiasgidknnskvgtfkstkgrhyvfiykhdsasnisyslnik

SCOPe Domain Coordinates for d5ikua1:

Click to download the PDB-style file with coordinates for d5ikua1.
(The format of our PDB-style files is described here.)

Timeline for d5ikua1:

  • d5ikua1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16