Lineage for d5ipfc_ (5ipf C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467648Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2467649Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2468152Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2468153Protein automated matches [190891] (33 species)
    not a true protein
  7. 2468200Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [331002] (1 PDB entry)
  8. 2468203Domain d5ipfc_: 5ipf C: [331003]
    automated match to d2vfab_
    complexed with imp

Details for d5ipfc_

PDB Entry: 5ipf (more details), 2.8 Å

PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from schistosoma mansoni in complex with imp
PDB Compounds: (C:) Hypoxanthine-guanine phosphoribosyltransferase (HGPRT)

SCOPe Domain Sequences for d5ipfc_:

Sequence, based on SEQRES records: (download)

>d5ipfc_ c.61.1.0 (C:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
dcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnatsi
tlmcvlkggfkfladlvdglertvrargivlpmsvefvrvksyvndvsihepiltglgdp
seykdknvlvvediidtgktitklishldslstksvkvasllvkrtsprndyrpdfvgfe
vpnrfvvgyaldyndnfrdlhhicvinevgqkkfsv

Sequence, based on observed residues (ATOM records): (download)

>d5ipfc_ c.61.1.0 (C:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
dcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnatsi
tlmcvlkggfkfladlvdglertvrargivlpmsvefeykdknvlvvediitgktitkli
shldslstksvkvasllvkrdyrpdfvgfevpnrfvvgyaldyndnfrdlhhicvinevg
qkkfsv

SCOPe Domain Coordinates for d5ipfc_:

Click to download the PDB-style file with coordinates for d5ipfc_.
(The format of our PDB-style files is described here.)

Timeline for d5ipfc_: