SCOP 1.65: Domain d1ay0a3: 1ay0 A:535-680

Lineage for d1ay0a3 (1ay0 A:535-680)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)

6. Protein Transketolase (TK), C-domain [52924] (3 species)
   two N-terminal domains are PP and Pyr modules of thiamin-binding fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)

8. Domain d1ay0a3: 1ay0 A:535-680 [33100]
   Other proteins in same PDB: d1ay0a1, d1ay0a2, d1ay0b1, d1ay0b2

Details for d1ay0a3

PDB Entry: 1ay0, 2.6 Å

PDB Description: identification of catalytically important residues in yeast transketolase

SCOP Domain Sequences for d1ay0a3:

Sequence; same for both SEQRES and ATOM records:

>d1ay0a3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1ay0a3:

• d1ay0a3 first appeared (with stable ids) in SCOP 1.55
  
• d1ay0a3 appears in SCOP 1.63
  
• d1ay0a3 appears in SCOP 1.67
  
• d1ay0a3 appears in the current release, SCOPe 2.08