SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hzui_ (5hzu I:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165406Species Echinophyllia sp. [TaxId:301887] [188534] (16 PDB entries)
  8. 2287690Domain d5hzui_: 5hzu I: [330991]
    automated match to d2gx2a_
    complexed with ni

Details for d5hzui_

PDB Entry: 5hzu (more details), 1.89 Å

PDB Description: crystal structure of dronpa-ni2+
PDB Compounds: (I:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d5hzui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hzui_ d.22.1.0 (I:) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
vqlpdyhfvdhhieikshdkdysnvnlhehaeahs

SCOPe Domain Coordinates for d5hzui_:

Click to download the PDB-style file with coordinates for d5hzui_.
(The format of our PDB-style files is described here.)

Timeline for d5hzui_:

  • d5hzui_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16