Lineage for d1ngsb3 (1ngs B:535-680)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487348Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 487349Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 487350Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 487357Protein Transketolase (TK), C-domain [52924] (3 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 487358Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. 487366Domain d1ngsb3: 1ngs B:535-680 [33099]
    Other proteins in same PDB: d1ngsa1, d1ngsa2, d1ngsb1, d1ngsb2

Details for d1ngsb3

PDB Entry: 1ngs (more details), 2.4 Å

PDB Description: complex of transketolase with thiamin diphosphate, ca2+ and acceptor substrate erythrose-4-phosphate

SCOP Domain Sequences for d1ngsb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngsb3 c.48.1.1 (B:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOP Domain Coordinates for d1ngsb3:

Click to download the PDB-style file with coordinates for d1ngsb3.
(The format of our PDB-style files is described here.)

Timeline for d1ngsb3: