SCOPe 2.06: Domain d5b7db1: 5b7d B:86-301

Lineage for d5b7db1 (5b7d B:86-301)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:672] [330964] (5 PDB entries)

8. Domain d5b7db1: 5b7d B:86-301 [330988]
   Other proteins in same PDB: d5b7da2, d5b7db2
   automated match to d1i6aa_
   complexed with so4; mutant

Details for d5b7db1

PDB Entry: 5b7d, 1.52 Å

PDB Description: oxyr2 e204g mutant regulatory domain from vibrio vulnificus (sulfate- bound)

PDB Compounds: (B:) LysR family transcriptional regulator

SCOPe Domain Sequences for d5b7db1:

Sequence, based on SEQRES records:

>d5b7db1 c.94.1.0 (B:86-301) automated matches {Vibrio vulnificus [TaxId: 672]}
elgslcqgdsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrh
geldvlilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekgh
cltehavsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvi
eppgqqayrdiglvwrpsssrsktfnqlaevvsell

Sequence, based on observed residues (ATOM records):

>d5b7db1 c.94.1.0 (B:86-301) automated matches {Vibrio vulnificus [TaxId: 672]}
eldsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrhgeldvl
ilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekghclteha
vsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvieppgqq
ayrdiglvwrpsssrsktfnqlaevvsell

Timeline for d5b7db1:

• d5b7db1 is new in SCOPe 2.06-stable
  
• d5b7db1 appears in SCOPe 2.07
  
• d5b7db1 appears in the current release, SCOPe 2.08