SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hntc_ (5hnt C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081137Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2081138Species Human (Homo sapiens) [TaxId:9606] [102052] (42 PDB entries)
    Uniprot P42330
  8. 2287677Domain d5hntc_: 5hnt C: [330978]
    automated match to d3uwea_
    complexed with nap, qap

Details for d5hntc_

PDB Entry: 5hnt (more details), 2 Å

PDB Description: crystal structure of akr1c3 complexed with cape
PDB Compounds: (C:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d5hntc_:

Sequence, based on SEQRES records: (download)

>d5hntc_ c.1.7.1 (C:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypys

Sequence, based on observed residues (ATOM records): (download)

>d5hntc_ c.1.7.1 (C:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpv
ifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkykpvcnqvechpyf
nrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcalakkhkrtpalial
ryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhyfnsdsfashpny
pys

SCOPe Domain Coordinates for d5hntc_:

Click to download the PDB-style file with coordinates for d5hntc_.
(The format of our PDB-style files is described here.)

Timeline for d5hntc_:

  • d5hntc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16