Lineage for d5hntc_ (5hnt C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081137Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2081138Species Human (Homo sapiens) [TaxId:9606] [102052] (43 PDB entries)
    Uniprot P42330
  8. 2287677Domain d5hntc_: 5hnt C: [330978]
    automated match to d3uwea_
    complexed with nap, qap

Details for d5hntc_

PDB Entry: 5hnt (more details), 2 Å

PDB Description: crystal structure of akr1c3 complexed with cape
PDB Compounds: (C:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d5hntc_:

Sequence, based on SEQRES records: (download)

>d5hntc_ c.1.7.1 (C:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypys

Sequence, based on observed residues (ATOM records): (download)

>d5hntc_ c.1.7.1 (C:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpv
ifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkykpvcnqvechpyf
nrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcalakkhkrtpalial
ryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhyfnsdsfashpny
pys

SCOPe Domain Coordinates for d5hntc_:

Click to download the PDB-style file with coordinates for d5hntc_.
(The format of our PDB-style files is described here.)

Timeline for d5hntc_:

  • d5hntc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16