SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h68a_ (5h68 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (123 species)
    not a true protein
  7. 2287675Species Geobacillus stearothermophilus [TaxId:272567] [330976] (1 PDB entry)
  8. 2287676Domain d5h68a_: 5h68 A: [330977]
    automated match to d1e69a_
    complexed with ags, mg

Details for d5h68a_

PDB Entry: 5h68 (more details), 1.98 Å

PDB Description: crystal structure of an engaged dimer of the geobacillus stearothermophilus smc head domain
PDB Compounds: (A:) Chromosome partition protein Smc

SCOPe Domain Sequences for d5h68a_:

Sequence, based on SEQRES records: (download)

>d5h68a_ c.37.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
mflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslrgak
medvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrqpcr
lkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvlkgsgggsgeemk
krflttfeqirahfgevfgelfgggradlrltdpndlletgidivaqppgkklqhlslls
ggeraltaiallfsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivithr
kgtmeeadvlygvtmqesgvsklvsvrledskelvrs

Sequence, based on observed residues (ATOM records): (download)

>d5h68a_ c.37.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
mflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslrgak
medvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrqpcr
lkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvkkrflttfeqira
hfgevfgelfgggradlrltdpndlletgidivaqppgkklqhlsllsggeraltaiall
fsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivithrkgtmeeadvlyg
vtmqesgvsklvsvrledskelvrs

SCOPe Domain Coordinates for d5h68a_:

Click to download the PDB-style file with coordinates for d5h68a_.
(The format of our PDB-style files is described here.)

Timeline for d5h68a_:

  • d5h68a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16