SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g31a_ (5g31 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2116934Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2117228Protein automated matches [190442] (13 species)
    not a true protein
  7. 2117275Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (10 PDB entries)
  8. 2287673Domain d5g31a_: 5g31 A: [330974]
    automated match to d4aj8a_
    complexed with zn; mutant

Details for d5g31a_

PDB Entry: 5g31 (more details), 2 Å

PDB Description: crystallographic structure of mutant c73s of thioredoxin from litopenaeus vannamei
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5g31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g31a_ c.47.1.1 (A:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiasmptflfmkngqkldslsganydkllelveknk

SCOPe Domain Coordinates for d5g31a_:

Click to download the PDB-style file with coordinates for d5g31a_.
(The format of our PDB-style files is described here.)

Timeline for d5g31a_:

  • d5g31a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16