SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b4ja_ (5b4j A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214634Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 2214675Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family) (S)
    Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349
  5. 2214676Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 protein domains)
  6. 2214695Protein automated matches [254531] (2 species)
    not a true protein
  7. 2287664Species Synechocystis sp. [TaxId:1148] [330965] (3 PDB entries)
  8. 2287672Domain d5b4ja_: 5b4j A: [330973]
    automated match to d3i94a_
    complexed with bla; mutant

Details for d5b4ja_

PDB Entry: 5b4j (more details), 1.05 Å

PDB Description: crystal structure of i86d mutant of phycocyanobilin:ferredoxin oxidoreductase in complex with biliverdin (data 3)
PDB Compounds: (A:) Phycocyanobilin:ferredoxin oxidoreductase

SCOPe Domain Sequences for d5b4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b4ja_ d.248.2.1 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
ltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvienrcyqt
pqfrkmhlelakvgkglddlhcvmfpeplyglplfgcdivagpggvsaaiadlsptqsdr
qlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrvvdflqih
chqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaerymsqvlfdvi

SCOPe Domain Coordinates for d5b4ja_:

Click to download the PDB-style file with coordinates for d5b4ja_.
(The format of our PDB-style files is described here.)

Timeline for d5b4ja_:

  • d5b4ja_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16