Lineage for d5b4ha_ (5b4h A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214634Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 2214675Superfamily d.248.2: Ferredoxin-dependent bilin reductase [254140] (1 family) (S)
    Pfam PF05996; PubMed 16380422; possibly related to (d.248.1) based on remote homology to chlorophyll catabolic enzimes discussed in PubMed 11283349
  5. 2214676Family d.248.2.1: Ferredoxin-dependent bilin reductase [254184] (2 protein domains)
  6. 2214695Protein automated matches [254531] (2 species)
    not a true protein
  7. 2287664Species Synechocystis sp. [TaxId:1148] [330965] (3 PDB entries)
  8. 2287665Domain d5b4ha_: 5b4h A: [330966]
    automated match to d3i94a_
    complexed with bla; mutant

Details for d5b4ha_

PDB Entry: 5b4h (more details), 1.11 Å

PDB Description: crystal structure of i86d mutant of phycocyanobilin:ferredoxin oxidoreductase in complex with biliverdin (data 1)
PDB Compounds: (A:) Phycocyanobilin:ferredoxin oxidoreductase

SCOPe Domain Sequences for d5b4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b4ha_ d.248.2.1 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
ltnsslmptlnpmiqqlalaiaaswqslplkpyqlpedlgyvegrlegeklvienrcyqt
pqfrkmhlelakvgkglddlhcvmfpeplyglplfgcdivagpggvsaaiadlsptqsdr
qlpaayqkslaelgqpefeqqrelppwgeifseyclfirpsnvteeerfvqrvvdflqih
chqsivaeplseaqtlehrqgqihycqqqqkndktrrvlekafgeawaerymsqvlfdvi

SCOPe Domain Coordinates for d5b4ha_:

Click to download the PDB-style file with coordinates for d5b4ha_.
(The format of our PDB-style files is described here.)

Timeline for d5b4ha_:

  • d5b4ha_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-16