Lineage for d5t4zl2 (5t4z L:108-211)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2026089Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (7 PDB entries)
  8. 2287660Domain d5t4zl2: 5t4z L:108-211 [330961]
    Other proteins in same PDB: d5t4zb1, d5t4zl1
    automated match to d1aqkl2
    complexed with ca, man

Details for d5t4zl2

PDB Entry: 5t4z (more details), 1.99 Å

PDB Description: structure of the anti-hiv antibody dh501 that binds gp120 v3 glycan and the base of v3 with free man9 glycan
PDB Compounds: (L:) antibody DH501 L chain

SCOPe Domain Sequences for d5t4zl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4zl2 b.1.1.2 (L:108-211) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasptvtlfppsseelqankatlvclisdfypgvvkvawkadgsavnagvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvapaec

SCOPe Domain Coordinates for d5t4zl2:

Click to download the PDB-style file with coordinates for d5t4zl2.
(The format of our PDB-style files is described here.)

Timeline for d5t4zl2:

  • d5t4zl2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5t4zl1