SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uuwa1 (5uuw A:1-486)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2287184Species Bacillus anthracis [TaxId:1392] [330485] (5 PDB entries)
  8. 2287653Domain d5uuwa1: 5uuw A:1-486 [330954]
    Other proteins in same PDB: d5uuwa2, d5uuwb2, d5uuwc2, d5uuwd2, d5uuwe2, d5uuwf2, d5uuwg2, d5uuwh2
    automated match to d4q33e_
    complexed with 8n1, edo, gol, imp, k

Details for d5uuwa1

PDB Entry: 5uuw (more details), 2.34 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from bacillus anthracis in the complex with imp and the inhibitor p221
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5uuwa1:

Sequence, based on SEQRES records: (download)

>d5uuwa1 c.1.5.0 (A:1-486) automated matches {Bacillus anthracis [TaxId: 1392]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp
ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5uuwa1 c.1.5.0 (A:1-486) automated matches {Bacillus anthracis [TaxId: 1392]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgameklvpegiegrvpykgpladtvhqlvgglr
agmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys

SCOPe Domain Coordinates for d5uuwa1:

Click to download the PDB-style file with coordinates for d5uuwa1.
(The format of our PDB-style files is described here.)

Timeline for d5uuwa1:

  • d5uuwa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09