Lineage for d5wz1d_ (5wz1 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893582Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. 2893632Protein automated matches [190302] (11 species)
    not a true protein
  7. 2893695Species Zika virus (strain mr 766) [TaxId:64320] [322798] (8 PDB entries)
  8. 2893711Domain d5wz1d_: 5wz1 D: [330950]
    automated match to d2px5a_
    complexed with sam

Details for d5wz1d_

PDB Entry: 5wz1 (more details), 2.51 Å

PDB Description: crystal structure of zika virus ns5 methyltransferase bound to s- adenosyl-l-methionine
PDB Compounds: (D:) NS5 methyltransferase

SCOPe Domain Sequences for d5wz1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wz1d_ c.66.1.25 (D:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl
vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepvlvqsygwnivr
lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc
pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd
gprrpvkyeedvnlgsgtr

SCOPe Domain Coordinates for d5wz1d_:

Click to download the PDB-style file with coordinates for d5wz1d_.
(The format of our PDB-style files is described here.)

Timeline for d5wz1d_: