SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ux9a_ (5ux9 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (29 species)
    not a true protein
  7. 2287558Species Vibrio fischeri [TaxId:312309] [330859] (1 PDB entry)
  8. 2287648Domain d5ux9a_: 5ux9 A: [330949]
    automated match to d3eevb_
    complexed with act, cl, fmt, mes, mg

Details for d5ux9a_

PDB Entry: 5ux9 (more details), 2.7 Å

PDB Description: the crystal structure of chloramphenicol acetyltransferase from vibrio fischeri es114
PDB Compounds: (A:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d5ux9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ux9a_ b.81.1.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
afnswlegqnlkeqvknpnievgdysyysgfyhsktfeeqavryllgdaptqevwesgqf
gevdklrigkfcsiasgatfmmagnqghradwistfpfskkefgegvkdgfqragdtivg
ndvwigseamimpgvhigdgaiigaravitknvapysvvvgnnvvvkkrfdenliqtllv
ikwwdwplqhikntmeilcsghieeleqyfiknvg

SCOPe Domain Coordinates for d5ux9a_:

Click to download the PDB-style file with coordinates for d5ux9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ux9a_:

  • d5ux9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09