SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t18a1 (5t18 A:396-658)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (14 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (583 PDB entries)
  8. 2287638Domain d5t18a1: 5t18 A:396-658 [330939]
    Other proteins in same PDB: d5t18a2
    automated match to d4z3va_
    complexed with 73t

Details for d5t18a1

PDB Entry: 5t18 (more details), 1.5 Å

PDB Description: crystal structure of bruton agammabulinemia tyrosine kinase complexed with bms-986142 aka (2s)-6-fluoro-5-[3-(8-fluoro-1-methyl-2,4-dioxo- 1,2,3,4-tetrahydroquinazolin-3-yl)-2-methylphenyl]-2-(2- hydroxypropan-2-yl)-2,3,4,9-tetrahydro-1h-carbazole-8-carboxamide
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5t18a1:

Sequence, based on SEQRES records: (download)

>d5t18a1 d.144.1.7 (A:396-658) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
klvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameylesk
qflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfs
sksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwh
ekaderptfkillsnildvmdee

Sequence, based on observed residues (ATOM records): (download)

>d5t18a1 d.144.1.7 (A:396-658) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
klvqlygvctkqrpifiiteymangcllnylrefqtqqllemckdvceameyleskqflh
rdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfssksd
iwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhekad
erptfkillsnildvmdee

SCOPe Domain Coordinates for d5t18a1:

Click to download the PDB-style file with coordinates for d5t18a1.
(The format of our PDB-style files is described here.)

Timeline for d5t18a1:

  • d5t18a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5t18a2