Lineage for d5t18a1 (5t18 A:396-658)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (15 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (627 PDB entries)
  8. 2287638Domain d5t18a1: 5t18 A:396-658 [330939]
    Other proteins in same PDB: d5t18a2
    automated match to d4z3va_
    complexed with 73t

Details for d5t18a1

PDB Entry: 5t18 (more details), 1.5 Å

PDB Description: crystal structure of bruton agammabulinemia tyrosine kinase complexed with bms-986142 aka (2s)-6-fluoro-5-[3-(8-fluoro-1-methyl-2,4-dioxo- 1,2,3,4-tetrahydroquinazolin-3-yl)-2-methylphenyl]-2-(2- hydroxypropan-2-yl)-2,3,4,9-tetrahydro-1h-carbazole-8-carboxamide
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5t18a1:

Sequence, based on SEQRES records: (download)

>d5t18a1 d.144.1.7 (A:396-658) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
klvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameylesk
qflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfs
sksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwh
ekaderptfkillsnildvmdee

Sequence, based on observed residues (ATOM records): (download)

>d5t18a1 d.144.1.7 (A:396-658) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
klvqlygvctkqrpifiiteymangcllnylrefqtqqllemckdvceameyleskqflh
rdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfssksd
iwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhekad
erptfkillsnildvmdee

SCOPe Domain Coordinates for d5t18a1:

Click to download the PDB-style file with coordinates for d5t18a1.
(The format of our PDB-style files is described here.)

Timeline for d5t18a1:

  • d5t18a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5t18a2