SCOP 1.59: Domain d1tkbb3: 1tkb B:535-680

Lineage for d1tkbb3 (1tkb B:535-680)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)

4. Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: Transketolase [52923] (1 protein)

6. Protein Transketolase [52924] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)

8. Domain d1tkbb3: 1tkb B:535-680 [33093]
   Other proteins in same PDB: d1tkba1, d1tkba2, d1tkbb1, d1tkbb2

Details for d1tkbb3

PDB Entry: 1tkb, 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkbb3:

Sequence; same for both SEQRES and ATOM records:

>d1tkbb3 c.48.1.1 (B:535-680) Transketolase {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1tkbb3:

• d1tkbb3 first appeared (with stable ids) in SCOP 1.55
  
• d1tkbb3 appears in SCOP 1.57
  
• d1tkbb3 appears in SCOP 1.61
  
• d1tkbb3 appears in the current release, SCOPe 2.08