Lineage for d1tkbb3 (1tkb B:535-680)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71301Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)
  4. 71302Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) (S)
  5. 71303Family c.48.1.1: Transketolase [52923] (1 protein)
  6. 71304Protein Transketolase [52924] (1 species)
  7. 71305Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (6 PDB entries)
  8. 71309Domain d1tkbb3: 1tkb B:535-680 [33093]
    Other proteins in same PDB: d1tkba1, d1tkba2, d1tkbb1, d1tkbb2

Details for d1tkbb3

PDB Entry: 1tkb (more details), 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkbb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkbb3 c.48.1.1 (B:535-680) Transketolase {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOP Domain Coordinates for d1tkbb3:

Click to download the PDB-style file with coordinates for d1tkbb3.
(The format of our PDB-style files is described here.)

Timeline for d1tkbb3: