Lineage for d5wz2a_ (5wz2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145865Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 2145910Protein automated matches [190302] (8 species)
    not a true protein
  7. 2145934Species Zika virus (strain mr 766) [TaxId:64320] [322798] (7 PDB entries)
  8. 2145951Domain d5wz2a_: 5wz2 A: [330926]
    automated match to d2px5a_
    complexed with gta, sam

Details for d5wz2a_

PDB Entry: 5wz2 (more details), 2.6 Å

PDB Description: crystal structure of zika virus ns5 methyltransferase bound to sam and rna analogue (m7gpppa)
PDB Compounds: (A:) NS5 MTase

SCOPe Domain Sequences for d5wz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wz2a_ c.66.1.25 (A:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl
vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepvlvqsygwnivr
lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc
pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd
gprrpvkyeedvnlgsgtr

SCOPe Domain Coordinates for d5wz2a_:

Click to download the PDB-style file with coordinates for d5wz2a_.
(The format of our PDB-style files is described here.)

Timeline for d5wz2a_: