SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wz2a_ (5wz2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129978Protein automated matches [190302] (8 species)
    not a true protein
  7. 2279497Species Zika virus (strain mr 766) [TaxId:64320] [322798] (6 PDB entries)
  8. 2287625Domain d5wz2a_: 5wz2 A: [330926]
    automated match to d2px5a_
    complexed with gta, sam

Details for d5wz2a_

PDB Entry: 5wz2 (more details), 2.6 Å

PDB Description: crystal structure of zika virus ns5 methyltransferase bound to sam and rna analogue (m7gpppa)
PDB Compounds: (A:) NS5 MTase

SCOPe Domain Sequences for d5wz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wz2a_ c.66.1.25 (A:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl
vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepvlvqsygwnivr
lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc
pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd
gprrpvkyeedvnlgsgtr

SCOPe Domain Coordinates for d5wz2a_:

Click to download the PDB-style file with coordinates for d5wz2a_.
(The format of our PDB-style files is described here.)

Timeline for d5wz2a_:

  • d5wz2a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09