SCOPe 2.08: Domain d5uveh1: 5uve H:26-303

Lineage for d5uveh1 (5uve H:26-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Brucella abortus [TaxId:359391] [328149] (2 PDB entries)

8. Domain d5uveh1: 5uve H:26-303 [330919]
   Other proteins in same PDB: d5uvea2, d5uveb2, d5uvec2, d5uved2, d5uvee2, d5uvef2, d5uveg2, d5uveh2
   automated match to d4ne4a_
   complexed with ca, gol

Details for d5uveh1

PDB Entry: 5uve, 2.5 Å

PDB Description: crystal structure of the abc transporter substrate-binding protein bab1_0226 from brucella abortus

PDB Compounds: (H:) Substrate-binding region of ABC-type glycine betaine transport system

SCOPe Domain Sequences for d5uveh1:

Sequence; same for both SEQRES and ATOM records:

>d5uveh1 c.94.1.0 (H:26-303) automated matches {Brucella abortus [TaxId: 359391]}
vavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytgna
afffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenklas
lsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatiaaa
anqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieellkp
vfekldlttlqdlngrvqlggepakavaedflkkngfl

Timeline for d5uveh1:

• d5uveh1 first appeared in SCOPe 2.06
  
• d5uveh1 appears in SCOPe 2.07