SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uy7a_ (5uy7 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (38 species)
    not a true protein
  7. 2287614Species Burkholderia ambifaria [TaxId:398577] [330915] (1 PDB entry)
  8. 2287615Domain d5uy7a_: 5uy7 A: [330916]
    automated match to d4bjpa1
    complexed with so4

Details for d5uy7a_

PDB Entry: 5uy7 (more details), 1.65 Å

PDB Description: crystal structure of a peptidoglycan glycosyltransferase from burkholderia ambifaria
PDB Compounds: (A:) Peptidoglycan glycosyltransferase

SCOPe Domain Sequences for d5uy7a_:

Sequence, based on SEQRES records: (download)

>d5uy7a_ e.3.1.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
glsidskiqyiayanlkaavekfkakagaamvvdvrtgevlalvnyptynpndrtrltge
qlrnriltdvfepgsimkpftvslaldlhrvtpntlvetgnghfvldgapitddagfgtl
tvggviqkssnigatkiamtmrpeemwnmytsiglgqapkvgfpgaaagrlrpwkswrri
eqatmsygyglsvslfqlaraytaiahdgemmpvtifktdpnqqitgtqvftpttarevr
tmletvvapggtspdaavpgyrvggksgtaykheghgytrkyrasfvgmapmpnprivva
vsvdeptagshfggqvsgpvfsaiagdtmralnvppnmpi

Sequence, based on observed residues (ATOM records): (download)

>d5uy7a_ e.3.1.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
glsidskiqyiayanlkaavekfkakagaamvvdvrtgevlalvnyptyrnriltdvfep
gsimkpftvslaldlhrvtpntlvetgnghfvldgapitddagfgtltvggviqkssnig
atkiamtmrpeemwnmytsiglgqapkvgfpgaaagrlrpwkswrrieqatmsygyglsv
slfqlaraytaiahdgemmpvtifktdpnqqitgtqvftpttarevrtmletvvapggts
pdaavpgyrvggksgtaykrkyrasfvgmapmpnprivvavsvdeptfggqvsgpvfsai
agdtmralnvppnmpi

SCOPe Domain Coordinates for d5uy7a_:

Click to download the PDB-style file with coordinates for d5uy7a_.
(The format of our PDB-style files is described here.)

Timeline for d5uy7a_:

  • d5uy7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09