Lineage for d5uy7a_ (5uy7 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2287614Species Burkholderia ambifaria [TaxId:398577] [330915] (1 PDB entry)
  8. 2287615Domain d5uy7a_: 5uy7 A: [330916]
    automated match to d4bjpa1
    complexed with so4

Details for d5uy7a_

PDB Entry: 5uy7 (more details), 1.65 Å

PDB Description: crystal structure of a peptidoglycan glycosyltransferase from burkholderia ambifaria
PDB Compounds: (A:) Peptidoglycan glycosyltransferase

SCOPe Domain Sequences for d5uy7a_:

Sequence, based on SEQRES records: (download)

>d5uy7a_ e.3.1.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
glsidskiqyiayanlkaavekfkakagaamvvdvrtgevlalvnyptynpndrtrltge
qlrnriltdvfepgsimkpftvslaldlhrvtpntlvetgnghfvldgapitddagfgtl
tvggviqkssnigatkiamtmrpeemwnmytsiglgqapkvgfpgaaagrlrpwkswrri
eqatmsygyglsvslfqlaraytaiahdgemmpvtifktdpnqqitgtqvftpttarevr
tmletvvapggtspdaavpgyrvggksgtaykheghgytrkyrasfvgmapmpnprivva
vsvdeptagshfggqvsgpvfsaiagdtmralnvppnmpi

Sequence, based on observed residues (ATOM records): (download)

>d5uy7a_ e.3.1.0 (A:) automated matches {Burkholderia ambifaria [TaxId: 398577]}
glsidskiqyiayanlkaavekfkakagaamvvdvrtgevlalvnyptyrnriltdvfep
gsimkpftvslaldlhrvtpntlvetgnghfvldgapitddagfgtltvggviqkssnig
atkiamtmrpeemwnmytsiglgqapkvgfpgaaagrlrpwkswrrieqatmsygyglsv
slfqlaraytaiahdgemmpvtifktdpnqqitgtqvftpttarevrtmletvvapggts
pdaavpgyrvggksgtaykrkyrasfvgmapmpnprivvavsvdeptfggqvsgpvfsai
agdtmralnvppnmpi

SCOPe Domain Coordinates for d5uy7a_:

Click to download the PDB-style file with coordinates for d5uy7a_.
(The format of our PDB-style files is described here.)

Timeline for d5uy7a_:

  • d5uy7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09